SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q99638 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q99638
Domain Number 1 Region: 6-128
Classification Level Classification E-value
Superfamily DNA clamp 3.42e-18
Family DNA polymerase processivity factor 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q99638
Sequence length 391
Comment (sp|Q99638|RAD9A_HUMAN) DNA repair exonuclease rad9 homolog A KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RAD9A; OC=Catarrhini; Hominidae; Homo.
Sequence
MKCLVTGGNVKVLGKAVHSLSRIGDELYLEPLEDGLSLRTVNSSRSAYACFLFAPLFFQQ
YQAATPGQDLLRCKILMKSFLSVFRSLAMLEKTVEKCCISLNGRSSRLVVQLHCKFGVRK
THNLSFQDCESLQAVFDPASCPHMLRAPARVLGEAVLPFSPALAEVTLGIGRGRRVILRS
YHEEEADSTAKAMVTEMCLGEEDFQQLQAQEGVAITFCLKEFRGLLSFAESANLNLSIHF
DAPGRPAIFTIKDSLLDGHFVLATLSDTDSHSQDLGSPERHQPVPQLQAHSTPHPDDFAN
DDIDSYMIAMETTIGNEGSRVLPSISLSPGPQPPKSPGPHSEEEDEAEPSTVPGTPPPKK
FRSLFFGSILAPVRSPQGPSPVLAEDSEGEG
Download sequence
Identical sequences K7DL38 Q99638
HR3319 gi|4759022|ref|NP_004575.1| ENSP00000311360 9606.ENSP00000311360 ENSP00000311360 ENSP00000311360 NP_004575.1.87134 NP_004575.1.92137 XP_016776852.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]