SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q99714 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q99714
Domain Number 1 Region: 12-237
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.07e-68
Family Tyrosine-dependent oxidoreductases 0.000000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q99714
Sequence length 261
Comment (sp|Q99714|HCD2_HUMAN) Type II HADH KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=HSD17B10; OC=Catarrhini; Hominidae; Homo.
Sequence
MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVF
APADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDV
NLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTL
PIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAI
IENPFLNGEVIRLDGAIRMQP
Download sequence
Identical sequences A0A0S2Z410 H2QYN3 Q99714
400289 ENSP00000168216 9598.ENSPTRP00000037656 9606.ENSP00000168216 ENSP00000168216 ENSP00000472168 gi|4758504|ref|NP_004484.1| ENSPTRP00000037656 cath|current|1so8A00/6-253 d2o23b2 ENSP00000168216 ENSPTRP00000037656 1so8_A 1so8A NP_004484.1.87134 NP_004484.1.92137 XP_003317521.1.37143 XP_003805947.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]