SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q99819 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q99819
Domain Number 1 Region: 29-225
Classification Level Classification E-value
Superfamily E set domains 1.4e-69
Family RhoGDI-like 0.000000511
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q99819
Sequence length 225
Comment (sp|Q99819|GDIR3_HUMAN) Rho-GDI gamma KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ARHGDIG; OC=Catarrhini; Hominidae; Homo.
Sequence
MLGLDACELGAQLLELLRLALCARVLLADKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIR
QLDPDDRSLAKYKRVLLGPLPPAVDPSLPNVQVTRLTLLSEQAPGPVVMDLTGDLAVLKD
QVFVLKEGVDYRVKISFKVHREIVSGLKCLHHTYRRGLRVDKTVYMVGSYGPSAQEYEFV
TPVEEAPRGALVRGPYLVVSLFTDDDRTHHLSWEWGLCICQDWKD
Download sequence
Identical sequences F1T0H7 Q99819
NP_001167.2.87134 NP_001167.2.92137 ENSP00000408037 9606.ENSP00000219409 gi|83313661|ref|NP_001167.2| ENSP00000219409 ENSP00000219409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]