SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q99933 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q99933
Domain Number 1 Region: 211-345
Classification Level Classification E-value
Superfamily BAG domain 2.22e-53
Family BAG domain 0.000000819
Further Details:      
 
Domain Number 2 Region: 141-227
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000023
Family Ubiquitin-related 0.0000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q99933
Sequence length 345
Comment (sp|Q99933|BAG1_HUMAN) Bcl-2-associated athanogene 1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=BAG1; OC=Catarrhini; Hominidae; Homo.
Sequence
MAQRGGARRPRGDRERLGSRLRALRPGREPRQSEPPAQRGPPPSGRPPARSTASGHDRPT
RGAAAGARRPRMKKKTRRRSTRSEELTRSEELTLSEEATWSEEATQSEEATQGEEMNRSQ
EVTRDEESTRSEEVTREEMAAAGLTVTVTHSNEKHDLHVTSQQGSSEPVVQDLAQVVEEV
IGVPQSFQKLIFKGKSLKEMETPLSALGIQDGCRVMLIGKKNSPQEEVELKKLKHLEKSV
EKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPEN
FKDSRLKRKGLVKKVQAFLAECDTVEQNICQETERLQSTNFALAE
Download sequence
Identical sequences Q99933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]