SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9BS26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9BS26
Domain Number 1 Region: 22-142
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.13e-32
Family PDI-like 0.028
Further Details:      
 
Domain Number 2 Region: 141-243
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.47e-19
Family Calsequestrin 0.019
Further Details:      
 
Domain Number 3 Region: 240-368
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.64e-16
Family PDI-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9BS26
Sequence length 406
Comment (sp|Q9BS26|ERP44_HUMAN) Thioredoxin domain-containing protein 4 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ERP44; OC=Catarrhini; Hominidae; Homo.
Sequence
MHPAVFLSLPDLRCSLLLLVTWVFTPVTTEITSLDTENIDEILNNADVALVNFYADWCRF
SQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMK
REYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFER
VANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDK
CVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHAD
CDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREF
HHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDEL
Download sequence
Identical sequences A0A2J8WSI4 H2QXK9 Q9BS26
NP_055866.1.87134 NP_055866.1.92137 XP_002820091.2.23681 XP_003312248.1.37143 XP_003820684.1.60992 ENSP00000262455 ENSPTRP00000036210 ENSPTRP00000036210 9598.ENSPTRP00000036210 9600.ENSPPYP00000021788 9606.ENSP00000262455 ENSP00000262455 ENSP00000262455 gi|52487191|ref|NP_055866.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]