SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9BSH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9BSH3
Sequence length 213
Comment (sp|Q9BSH3|NICN1_HUMAN) Tubulin polyglutamylase complex subunit 5 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=NICN1; OC=Catarrhini; Hominidae; Homo.
Sequence
MSRVLVPCHVKGSVALQVGDVRTSQGRPGVLVIDVTFPSVAPFELQEITFKNYYTAFLSI
RVRQYTSAHTPAKWVTCLRDYCLMPDPHSEEGAQEYVSLFKHQMLCDMARISELRLILRQ
PSPLWLSFTVEELQIYQQGPKSPSVTFPKWLSHPVPCEQPALLREGLPDPSRVSSEVQQM
WALTEMIRASHTSARIGRFDVDGCYDLNLLSYT
Download sequence
Identical sequences B2R7Q3 Q9BSH3
gi|14150084|ref|NP_115692.1| ENSP00000273598 ENSP00000273598 ENSP00000413115 9606.ENSP00000273598 NP_115692.1.87134 NP_115692.1.92137 ENSP00000273598 ENSP00000413115 ENSP00000478287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]