SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9BT04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9BT04
Sequence length 418
Comment (sp|Q9BT04|FUZZY_HUMAN) Protein fuzzy homolog KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FUZ; OC=Catarrhini; Hominidae; Homo.
Sequence
MGEEGTGGTVHLLCLAASSGVPLFCRSSRGGAPARQQLPFSVIGSLNGVHMFGQNLEVQL
SSARTENTTVVWKSFHDSITLIVLSSEVGISELRLERLLQMVFGAMVLLVGLEELTNIRN
VERLKKDLRASYCLIDSFLGDSELIGDLTQCVDCVIPPEGSLLQEALSGFAEAAGTTFVS
LVVSGRVVAATEGWWRLGTPEAVLLPWLVGSLPPQTARDYPVYLPHGSPTVPHRLLTLTL
LPSLELCLLCGPSPPLSQLYPQLLERWWQPLLDPLRACLPLGPRALPSGFPLHTDILGLL
LLHLELKRCLFTVEPLGDKEPSPEQRRRLLRNFYTLVTSTHFPPEPGPPEKTEDEVYQAQ
LPRACYLVLGTEEPGTGVRLVALQLGLRRLLLLLSPQSPTHGLRSLATHTLHALTPLL
Download sequence
Identical sequences A0A024QZF7 H2QGW3 Q9BT04
ENSPTRP00000019429 NP_079405.2.87134 NP_079405.2.92137 XP_001173283.1.37143 gi|20149693|ref|NP_079405.2| ENSP00000313309 ENSP00000313309 9598.ENSPTRP00000019429 9606.ENSP00000313309 ENSPTRP00000019429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]