SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9BTP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9BTP7
Domain Number 1 Region: 158-214
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.0000000000000445
Family Hef domain-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9BTP7
Sequence length 215
Comment (sp|Q9BTP7|FAP24_HUMAN) Fanconi anemia-associated protein of 24 kDa KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FAAP24 OC=Catarrhini; Hominidae; Homo.
Sequence
MEKNPPDDTGPVHVPLGHIVANEKWRGSQLAQEMQGKIKLIFEDGLTPDFYLSNRCCILY
VTEADLVAGNGYRKRLVRVRNSNNLKGIVVVEKTRMSEQYFPALQKFTVLDLGMVLLPVA
SQMEASCLVIQLVQEQTKEPSKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQK
FPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR
Download sequence
Identical sequences A0A0S2Z5V6 Q9BTP7
GO.33724 NP_689479.1.87134 NP_689479.1.92137 9606.ENSP00000254262 gi|22748623|ref|NP_689479.1| ENSP00000466121 ENSP00000468475 ENSP00000254262 ENSP00000466121 ENSP00000468475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]