SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9BUL9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9BUL9
Domain Number 1 Region: 38-142
Classification Level Classification E-value
Superfamily AlbA-like 1.96e-18
Family DNA-binding protein AlbA 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9BUL9
Sequence length 199
Comment (sp|Q9BUL9|RPP25_HUMAN) Ribonuclease P protein subunit p25 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RPP25; OC=Catarrhini; Hominidae; Homo.
Sequence
MENFRKVRSEEAPAGCGAEGGGPGSGPFADLAPGAVHMRVKEGSKIRNLMAFATASMAQP
ATRAIVFSGCGRATTKTVTCAEILKRRLAGLHQVTRLRYRSVREVWQSLPPGPTQGQTPG
EPAASLSVLKNVPGLAILLSKDALDPRQPGYQPPNPHPGPSSPPAAPASKRSLGEPAAGE
GSAKRSQPEPGVADEDQTA
Download sequence
Identical sequences Q9BUL9
gi|93277074|ref|NP_060263.2| ENSP00000317691 NP_060263.2.87134 NP_060263.2.92137 ENSP00000317691 9606.ENSP00000317691 ENSP00000317691 ENSP00000446246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]