SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9BV29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9BV29
Sequence length 185
Comment (sp|Q9BV29|CCD32_HUMAN) Coiled-coil domain-containing protein 32 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=C15orf57 OC=Catarrhini; Hominidae; Homo.
Sequence
MKMFESADSTATRSGQDLWAEICSCLPNPEQEDGANNAFSDSFVDSCPEGEGQREVADFA
VQPAVKPWAPLQDSEVYLASLEKKLRRIKGLNQEVTSKDMLRTLAQAKKECWDRFLQEKL
ASEFFVDGLDSDESTLEHFKRWLQPDKVAVSTEEVQYLIPPESQVEKPVAEDEPAAGDKP
AAAEQ
Download sequence
Identical sequences A0A024R9J9 H2R2V4 Q9BV29
gi|124248537|ref|NP_001074261.1| gi|24308366|ref|NP_443081.1| NP_001074261.1.87134 NP_001074261.1.92137 NP_443081.1.87134 NP_443081.1.92137 XP_001143787.1.37143 XP_003314667.1.37143 ENSP00000350695 ENSP00000397515 ENSP00000453226 ENSP00000453607 GO.35210 HR2292 ENSP00000350695 ENSP00000397515 ENSP00000453226 ENSP00000453607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]