SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9BVC6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9BVC6
Sequence length 243
Comment (sp|Q9BVC6|TM109_HUMAN) Mitsugumin-23 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=TMEM109; OC=Catarrhini; Hominidae; Homo.
Sequence
MAASSISSPWGKHVFKAILMVLVALILLHSALAQSRRDFAPPGQQKREAPVDVLTQIGRS
VRGTLDAWIGPETMHLVSESSSQVLWAISSAISVAFFALSGIAAQLLNALGLAGDYLAQG
LKLSPGQVQTFLLWGAGALVVYWLLSLLLGLVLALLGRILWGLKLVIFLAGFVALMRSVP
DPSTRALLLLALLILYALLSRLTGSRASGAQLEAKVRGLERQVEELRWRQRRAAKGARSV
EEE
Download sequence
Identical sequences Q9BVC6
NP_076997.1.87134 NP_076997.1.92137 9606.ENSP00000227525 ENSP00000227525 ENSP00000443990 ENSP00000227525 ENSP00000443990 ENSP00000227525 gi|13129092|ref|NP_076997.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]