SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9BXI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9BXI9
Domain Number 1 Region: 125-255
Classification Level Classification E-value
Superfamily TNF-like 6.75e-34
Family TNF-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9BXI9
Sequence length 259
Comment (sp|Q9BXI9|C1QT6_HUMAN) Complement C1q tumor necrosis factor-related protein 6 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=C1QTNF6; OC=Catarrhini; Hominidae; Homo.
Sequence
MGTAALGPVWAALLLFLLMCEIPMVELTFDRAVASGCQRCCDSEDPLDPAHVSSASSSGR
PHALPEIRPYINITILKGDKGDPGPMGLPGYMGREGPQGEPGPQGSKGDKGEMGSPGAPC
QKRFFAFSVGRKTALHSGEDFQTLLFERVFVNLDGCFDMATGQFAAPLRGIYFFSLNVHS
WNYKETYVHIMHNQKEAVILYAQPSERSIMQSQSVMLDLAYGDRVWVRLFKRQRENAIYS
NDFDTYITFSGHLIKAEDD
Download sequence
Identical sequences Q9BXI9
XP_011528159.1.92137 XP_016884059.1.92137 XP_016884060.1.92137 XP_016884061.1.92137 XP_016884062.1.92137 XP_016884063.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]