SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9BXU8 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9BXU8
Domain Number 1 Region: 4-177
Classification Level Classification E-value
Superfamily Ferritin-like 3.48e-71
Family Ferritin 0.000000747
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
cytosol 1.295 64.93
fusome 2.182 15.07
oxidoreductase complex 1.828 13.98
plastid 1.525 4.44

Protein sequence

External link(s) Q9BXU8
Sequence length 183
Comment (sp|Q9BXU8|FHL17_HUMAN) Cancer/testis antigen 38 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FTHL17; OC=Catarrhini; Hominidae; Homo.
Sequence
MATAQPSQVRQKYDTNCDAAINSHITLELYTSYLYLSMAFYFNRDDVALENFFRYFLRLS
DDKMEHAQKLMRLQNLRGGHICLHDIRKPECQGWESGLVAMESAFHLEKNVNQSLLDLYQ
LAVEKGDPQLCHFLESHYLHEQVKTIKELGGYVSNLRKICSPEAGLAEYLFDKLTLGGRV
KET
Download sequence
Identical sequences Q9BXU8
400504 gi|13994244|ref|NP_114100.1| ENSP00000368207 9606.ENSP00000368207 ENSP00000368207 ENSP00000368207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]