SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9BXW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9BXW7
Domain Number 1 Region: 49-154,186-323,353-375
Classification Level Classification E-value
Superfamily HAD-like 8.26e-29
Family NagD-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9BXW7
Sequence length 423
Comment (sp|Q9BXW7|HDHD5_HUMAN) Cat eye syndrome critical region protein 5 {ECO:0000305} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CECR5 OC=Catarrhini; Hominidae; Homo.
Sequence
MAAWGCVAALGAARGLCWRAARAAAGLQGRPARRCYAVGPAQSPPTFGFLLDIDGVLVRG
HRVIPAALKAFRRLVNSQGQLRVPVVFVTNAGNILQHSKAQELSALLGCEVDADQVILSH
SPMKLFSEYHEKRMLVSGQGPVMENAQGLGFRNVVTVDELRMAFPLLDMVDLERRLKTTP
LPRNDFPRIEGVLLLGEPVRWETSLQLIMDVLLSNGSPGAGLATPPYPHLPVLASNMDLL
WMAEAKMPRFGHGTFLLCLETIYQKVTGKELRYEGLMGKPSILTYQYAEDLIRRQAERRG
WAAPIRKLYAVGDNPMSDVYGANLFHQYLQKATHDGAPELGAGGTRQQQPSASQSCISIL
VCTGVYNPRNPQSTEPVLGGGEPPFHGHRDLCFSPGLMEASHVVNDVNEAVQLVFRKEGW
ALE
Download sequence
Identical sequences Q9BXW7
NP_149061.1.87134 NP_149061.1.92137 ENSP00000337358 gi|14861834|ref|NP_149061.1| ENSP00000337358 9606.ENSP00000337358 NYSGRC-14861834 ENSP00000337358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]