SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9BY31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9BY31
Domain Number 1 Region: 424-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.95e-26
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 10-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-24
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 3 Region: 313-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-24
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 508-565
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.4e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 784-841
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 368-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 7 Region: 731-785
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.52e-21
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 8 Region: 564-621
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.89e-21
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 9 Region: 826-878
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.71e-20
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 10 Region: 610-659
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000164
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 11 Region: 259-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000213
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 12 Region: 471-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000241
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 13 Region: 169-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000101
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9BY31
Sequence length 904
Comment (sp|Q9BY31|ZN717_HUMAN) Krueppel-like factor X17 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ZNF717; OC=Catarrhini; Hominidae; Homo.
Sequence
MLETYNSLVSLQELVSFEEVAVHFTWEEWQDLDDAQRTLYRDVMLETYSSLVSLGHCITK
PEMIFKLEQGAEPWIVEETPNLRLSAVQIIDDLIERSHESHDRFFWQIVITNSNTSTQER
VELGKTFNLNSNHVLNLIINNGNSSGMKPGQFNDCQNMLFPIKPGETQSGEKPHVCDITR
RSHRHHEHLTQHHKIQTLLQTFQCNEQGKTFNTEAMFFIHKRVHIVQTFGKYNEYEKACN
NSAVIVQVITQVGQPTCCRKSDFTKHQQTHTGEKPYECVECEKPSISKSDLMLQCKMPTE
EKPYACNWCEKLFSYKSSLIIHQRIHTGEKPYGCNECGKTFRRKSFLTLHERTHTGDKPY
KCIECGKTFHCKSLLTLHHRTHSGEKPYQCSECGKTFSQKSYLTIHHRTHTGEKPYACDH
CEEAFSHKSRLTVHQRTHTGEKPYECNECGKPFINKSNLRLHQRTHTGEKPYECNECGKT
FHRKSFLTIHQWTHTGEKPYECNECGKTFRCKSFLTVHQRTHAGEKPYACNECGKTYSHK
SYLTVHHRTHTGEKPYECNECGKSFHCKSFLTIHQRTHAGKKPYECNECEKTFINKLNLG
IHKITHTGERPYECNECGKTFRQKSNLSTHQGTHTGEKPYVCGKTFHRKSFLTIHQRTHT
GKNRMDVMNVEKLFVRNHTLLYIRELTPGKSPMNVMNVENPFIRRQIFRSIKVFTRGRNP
MNVANVEKPCQKSVLTVHHRTHTGEKPYECNECGKTFCHKSNLSTHQGTHSGEKPYECDE
CRKTFYDKTVLTIHQRTHTGEKPFECKECRKTFSQKSKLFVHHRTHTGEKPFRCNECRKT
FSQKSGLSIHQRTHTGEKPYECKECGKTFCQKSHLSRHQQTHIGEKSDVAEAGYVFPQNH
SFFP
Download sequence
Identical sequences Q9BY31

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]