SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9C0C4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9C0C4
Domain Number 1 Region: 33-498
Classification Level Classification E-value
Superfamily Sema domain 1.2e-167
Family Sema domain 0.00000000148
Further Details:      
 
Domain Number 2 Region: 500-548
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000017
Family Plexin repeat 0.0011
Further Details:      
 
Domain Number 3 Region: 559-631
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000119
Family I set domains 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9C0C4
Sequence length 833
Comment (sp|Q9C0C4|SEM4C_HUMAN) Semaphorin-4C KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SEMA4C; OC=Catarrhini; Hominidae; Homo.
Sequence
MAPHWAVWLLAARLWGLGIGAEVWWNLVPRKTVSSGELATVVRRFSQTGIQDFLTLTLTE
PTGLLYVGAREALFAFSMEALELQGAISWEAPVEKKTECIQKGKNNQTECFNFIRFLQPY
NASHLYVCGTYAFQPKCTYVNMLTFTLEHGEFEDGKGKCPYDPAKGHAGLLVDGELYSAT
LNNFLGTEPIILRNMGPHHSMKTEYLAFWLNEPHFVGSAYVPESVGSFTGDDDKVYFFFR
ERAVESDCYAEQVVARVARVCKGDMGGARTLQRKWTTFLKARLACSAPNWQLYFNQLQAM
HTLQDTSWHNTTFFGVFQAQWGDMYLSAICEYQLEEIQRVFEGPYKEYHEEAQKWDRYTD
PVPSPRPGSCINNWHRRHGYTSSLELPDNILNFVKKHPLMEEQVGPRWSRPLLVKKGTNF
THLVADRVTGLDGATYTVLFIGTGDGWLLKAVSLGPWVHLIEELQLFDQEPMRSLVLSQS
KKLLFAGSRSQLVQLPVADCMKYRSCADCVLARDPYCAWSVNTSRCVAVGGHSGSLLIQH
VMTSDTSGICNLRGSKKVRPTPKNITVVAGTDLVLPCHLSSNLAHARWTFGGRDLPAEQP
GSFLYDARLQALVVMAAQPRHAGAYHCFSEEQGARLAAEGYLVAVVAGPSVTLEARAPLE
NLGLVWLAVVALGAVCLVLLLLVLSLRRRLREELEKGAKATERTLVYPLELPKEPTSPPF
RPCPEPDEKLWDPVGYYYSDGSLKIVPGHARCQPGGGPPSPPPGIPGQPLPSPTRLHLGG
GRNSNANGYVRLQLGGEDRGGLGHPLPELADELRRKLQQRQPLPDSNPEESSV
Download sequence
Identical sequences Q9C0C4
ENSP00000306844 ENSP00000306844 NP_060259.4.87134 NP_060259.4.92137 XP_011509680.1.92137 XP_011509681.1.92137 XP_011509682.1.92137 XP_011509683.1.92137 XP_011509684.1.92137 XP_011509685.1.92137 ENSP00000306844 9606.ENSP00000306844 NYSGRC-IgSF-SEM4C_HUMAN gi|157388902|ref|NP_060259.4|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]