SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9GZY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9GZY8
Sequence length 342
Comment (sp|Q9GZY8|MFF_HUMAN) Mitochondrial fission factor KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=MFF; OC=Catarrhini; Hominidae; Homo.
Sequence
MSKGTSSDTSLGRVSRAAFPSPTAAEMAEISRIQYEMEYTEGISQRMRVPEKLKVAPPNA
DLEQGFQEGVPNASVIMQVPERIVVAGNNEDVSFSRPADLDLIQSTPFKPLALKTPPRVL
TLSERPLDFLDLERPPTTPQNEEIRAVGRLKRERSMSENAVRQNGQLVRNDSLWHRSDSA
PRNKISRFQAPISAPEYTVTPSPQQARVCPPHMLPEDGANLSSARGILSLIQSSTRRAYQ
QILDVLDENRRPVLRGGSAAATSNPHHDNVRYGISNIDTTIEGTSDDLTVVDAASLRRQI
IKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLWFRR
Download sequence
Identical sequences A0A024R491 Q9GZY8
HR6771 ENSP00000302037 ENSP00000304898 NP_001263990.1.87134 NP_001263990.1.92137 NP_064579.3.87134 NP_064579.3.92137 XP_011509802.1.92137 ENSP00000302037 ENSP00000375912 gi|31377607|ref|NP_064579.3| 9606.ENSP00000302037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]