SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9H0A6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9H0A6
Domain Number 1 Region: 109-175
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000895
Family RING finger domain, C3HC4 0.021
Further Details:      
 
Domain Number 2 Region: 292-358
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000017
Family RING finger domain, C3HC4 0.0064
Further Details:      
 
Weak hits

Sequence:  Q9H0A6
Domain Number - Region: 185-212
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0425
Family Nucleotide and nucleoside kinases 0.092
Further Details:      
 
Domain Number - Region: 100-114
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0549
Family Formin homology 2 domain (FH2 domain) 0.12
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9H0A6
Sequence length 362
Comment (sp|Q9H0A6|RNF32_HUMAN) RING finger protein 32 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RNF32; OC=Catarrhini; Hominidae; Homo.
Sequence
MLKNKGHSSKKDNLAVNAVALQDHILHDLQLRNLSVADHSKTQVQKKENKSLKRDTKAII
DTGLKKTTQCPKLEDSEKEYVLDPKPPPLTLAQKLGLIGPPPPPLSSDEWEKVKQRSLLQ
GDSVQPCPICKEEFELRPQVLLSCSHVFHKACLQAFEKFTNKKTCPLCRKNQYQTRVIHD
GARLFRIKCVTRIQAYWRGCVVRKWYRNLRKTVPPTDAKLRKKFFEKKFTEISHRILCSY
NTNIEELFAEIDQCLAINRSVLQQLEEKCGHEITEEEWEKIQVQALRRETHECSICLAPL
SAAGGQRVGAGRRSREMALLSCSHVFHHACLLALEEFSVGDRPPFHACPLCRSCYQKKIL
EC
Download sequence
Identical sequences A0A024RD87 Q9H0A6
gi|13569903|ref|NP_112198.1| gi|297139739|ref|NP_001171925.1| gi|297139741|ref|NP_001171926.1| ENSP00000341185 ENSP00000315950 ENSP00000376499 ENSP00000385285 ENSP00000405588 ENSP00000315950 ENSP00000376499 ENSP00000385285 ENSP00000405588 9606.ENSP00000315950 NP_001171925.1.87134 NP_001171925.1.92137 NP_001171926.1.87134 NP_001171926.1.92137 NP_112198.1.87134 NP_112198.1.92137 XP_005249579.1.92137 XP_011514106.1.92137 XP_011514107.1.92137 XP_011514108.1.92137 XP_011514109.1.92137 XP_011514110.1.92137 XP_011514111.1.92137 XP_011514112.1.92137 XP_011514113.1.92137 XP_011514114.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]