SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9H251 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9H251
Domain Number 1 Region: 2497-2614
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-31
Family Cadherin 0.0012
Further Details:      
 
Domain Number 2 Region: 120-236
Classification Level Classification E-value
Superfamily Cadherin-like 5e-29
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 1090-1215
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-28
Family Cadherin 0.001
Further Details:      
 
Domain Number 4 Region: 878-990
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-28
Family Cadherin 0.0013
Further Details:      
 
Domain Number 5 Region: 1406-1529
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-27
Family Cadherin 0.0018
Further Details:      
 
Domain Number 6 Region: 2063-2166
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-27
Family Cadherin 0.00055
Further Details:      
 
Domain Number 7 Region: 454-561
Classification Level Classification E-value
Superfamily Cadherin-like 1.14e-26
Family Cadherin 0.00085
Further Details:      
 
Domain Number 8 Region: 2395-2502
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-26
Family Cadherin 0.0011
Further Details:      
 
Domain Number 9 Region: 1628-1744
Classification Level Classification E-value
Superfamily Cadherin-like 8.25e-26
Family Cadherin 0.0013
Further Details:      
 
Domain Number 10 Region: 1520-1626
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-25
Family Cadherin 0.0012
Further Details:      
 
Domain Number 11 Region: 1737-1843
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-24
Family Cadherin 0.00097
Further Details:      
 
Domain Number 12 Region: 989-1102
Classification Level Classification E-value
Superfamily Cadherin-like 6.71e-24
Family Cadherin 0.0012
Further Details:      
 
Domain Number 13 Region: 665-770
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-23
Family Cadherin 0.001
Further Details:      
 
Domain Number 14 Region: 2599-2724
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-23
Family Cadherin 0.0014
Further Details:      
 
Domain Number 15 Region: 1845-1959
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-23
Family Cadherin 0.0012
Further Details:      
 
Domain Number 16 Region: 554-663
Classification Level Classification E-value
Superfamily Cadherin-like 1.14e-22
Family Cadherin 0.0014
Further Details:      
 
Domain Number 17 Region: 1201-1305
Classification Level Classification E-value
Superfamily Cadherin-like 1.33e-22
Family Cadherin 0.0011
Further Details:      
 
Domain Number 18 Region: 771-878
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-19
Family Cadherin 0.0017
Further Details:      
 
Domain Number 19 Region: 1301-1425
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-19
Family Cadherin 0.0027
Further Details:      
 
Domain Number 20 Region: 2281-2389
Classification Level Classification E-value
Superfamily Cadherin-like 5e-19
Family Cadherin 0.0021
Further Details:      
 
Domain Number 21 Region: 1953-2069
Classification Level Classification E-value
Superfamily Cadherin-like 3e-17
Family Cadherin 0.00096
Further Details:      
 
Domain Number 22 Region: 2167-2285
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-16
Family Cadherin 0.00093
Further Details:      
 
Domain Number 23 Region: 231-348
Classification Level Classification E-value
Superfamily Cadherin-like 7.14e-16
Family Cadherin 0.0034
Further Details:      
 
Domain Number 24 Region: 2710-2809
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000414
Family Cadherin 0.0021
Further Details:      
 
Domain Number 25 Region: 29-132
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000685
Family Cadherin 0.0033
Further Details:      
 
Domain Number 26 Region: 341-451
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000286
Family Cadherin 0.0051
Further Details:      
 
Domain Number 27 Region: 2834-2952
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000471
Family Cadherin 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9H251
Sequence length 3354
Comment (sp|Q9H251|CAD23_HUMAN) Otocadherin KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CDH23; OC=Catarrhini; Hominidae; Homo.
Sequence
MGRHVATSCHVAWLLVLISGCWGQVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLAQDM
DNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNI
QVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSQFFAI
DSARGIVTVIRELDYETTQAYQLTVNATDQDKTRPLSTLANLAIIITDVQDMDPIFINLP
YSTNIYEHSPPGTTVRIITAIDQDKGRPRGIGYTIVSGNTNSIFALDYISGVLTLNGLLD
RENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITEL
AQVGFALPLFIQVVDKDENLGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLD
YETVDRYDFDLFANESVPDHVGYAKVKITLINENDNRPIFSQPLYNISLYENVTVGTSVL
TVLATDNDAGTFGEVSYFFSDDPDRFSLDKDTGLIMLIARLDYELIQRFTLTIIARDGGG
EETTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDEDSPPNNQITYSI
VSASAFGSYFDISLYEGYGVISVSRPLDYEQISNGLIYLTVMAMDAGNPPLNSTVPVTIE
VFDENDNPPTFSKPAYFVSVVENIMAGATVLFLNATDLDRSREYGQESIIYSLEGSTQFR
INARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNITLLDINDNHPTWKD
APYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIQPPNKFYSLNSTTGKIRTTHAML
DRENPDPHEAELMRKIVVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFQNLPFVAEVL
EGIPAGVSIYQVVAIDLDEGLNGLVSYRMPVGMPRMDFLINSSSGVVVTTTELDRERIAE
YQLRVVASDAGTPTKSSTSTLTIHVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWLNCT
DNDVGLNAELSYFITGGNVDGKFSVGYRDAVVRTVVGLDRETTAAYMLILEAIDNGPVGK
RHTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSILQLKATDADEGEFGRVWYR
ILHGNHGNNFRIHVSNGLLMRGPRPLDRERNSSHVLIVEAYNHDLGPMRSSVRVIVYVED
INDEAPVFTQQQYSRLGLRETAGIGTSVIVVQATDRDSGDGGLVNYRILSGAEGKFEIDE
STGLIITVNYLDYETKTSYMMNVSATDQAPPFNQGFCSVYITLLNELDEAVQFSNASYEA
AILENLALGTEIVRVQAYSIDNLNQITYRFNAYTSTQAKALFKIDAITGVITVQGLVDRE
KGDFYTLTVVADDGGPKVDSTVKVYITVLDENDNSPRFDFTSDSAVSIPEDCPVGQRVAT
VKAWDPDAGSNGQVVFSLASGNIAGAFEIVTTNDSIGEVFVARPLDREELDHYILQVVAS
DRGTPPRKKDHILQVTILDINDNPPVIESPFGYNVSVNENVGGGTAVVQVRATDRDIGIN
SVLSYYITEGNKDMAFRMDRISGEIATRPAPPDRERQSFYHLVATVEDEGTPTLSATTHV
YVTIVDENDNAPMFQQPHYEVLLDEGPDTLNTSLITIQALDLDEGPNGTVTYAIVAGNIV
NTFRIDRHMGVITAAKELDYEISHGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDN
VPTFPRDYEGPFEVTEGQPGPRVWTFLAHDRDSGPNGQVEYSIMDGDPLGEFVISPVEGV
LRVRKDVELDRETIAFYNLTICARDRGMPPLSSTMLVGIRVLDINDNDPVLLNLPMNITI
SENSPVSSFVAHVLASDADSGCNARLTFNITAGNRERAFFINATTGIVTVNRPLDRERIP
EYKLTISVKDNPENPRIARRDYDLLLIFLSDENDNHPLFTKSTYQAEVMENSPAGTPLTV
LNGPILALDADQDIYAVVTYQLLGAQSGLFDINSSTGVVTVRSGVIIDREAFSPPILELL
LLAEDIGLLNSTAHLLITILDDNDNRPTFSPATLTVHLLENCPPGFSVLQVTATDEDSGL
NGELVYRIEAGAQDRFLIHLVTGVIRVGNATIDREEQESYRLTVVATDRGTVPLSGTAIV
TILIDDINDSRPEFLNPIQTVSVLESAEPGTVIANITAIDHDLNPKLEYHIVGIVAKDDT
DRLVPNQEDAFAVNINTGSVMVKSPMNRELVATYEVTLSVIDNASDLPERSVSVPNAKLT
VNVLDVNDNTPQFKPFGITYYMERILEGATPGTTLIAVAAVDPDKGLNGLVTYTLLDLVP
PGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNP
IFDQPSYQEAVFEDVPVGTIILTVTATDADSGNFALIEYSLGDGESKFAINPTTGDIYVL
SSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIQVLDVNDCRPQFSKPQFSTSVYE
NEPAGTSVITMMATDQDEGPNGELTYSLEGPGVEAFHVDMDSGLVTTQRPLQSYEKFSLT
VVATDGGEPPLWGTTMLLVEVIDVNDNRPVFVRPPNGTILHIREEIPLRSNVYEVYATDK
DEGLNGAVRYSFLKTAGNRDWEFFIIDPISGLIQTAQRLDRESQAVYSLILVASDLGQPV
PYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEGP
NAIVYYFIAAGNEEKNFHLQPDGCLLVLRDLDREREAIFSFIVKASSNRSWTPPRGPSPT
LDLVADLTLQEVRVVLEDINDQPPRFTKAEYTAGVATDAKVGSELIQVLALDADIGNNSL
VFYSILAIHYFRALANDSEDVGQVFTMGSMDGILRTFDLFMAYSPGYFVVDIVARDLAGH
NDTAIIGIYILRDDQRVKIVINEIPDRVRGFEEEFIHLLSNITGAIVNTDNVQFHVDKKG
RVNFAQTELLIHVVNRDTNRILDVDRVIQMIDENKEQLRNLFRNYNVLDVQPAISVRLPD
DMSALQMAIIVLAILLFLAAMLFVLMNWYYRTVHKRKLKAIVAGSAGNRGFIDIMDMPNT
NKYSFDGANPVWLDPFCRNLELAAQAEHEDDLPENLSEIADLWNSPTRTHGTFGREPAAV
KPDDDRYLRAAIQEYDNIAKLGQIIREGPIKGSLLKVVLEDYLRLKKLFAQRMVQKASSC
HSSISELIQTELDEEPGDHSPGQGSLRFRHKPPVELKGPDGIHVVHGSTGTLLATDLNSL
PEEDQKGLGRSLETLTAAEATAFERNARTESAKSTPLHKLRDVIMETPLEITEL
Download sequence
Identical sequences Q9H251
NP_071407.4.87134 NP_071407.4.92137 gi|189571674|ref|NP_071407.4|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]