SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9H2H9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9H2H9
Sequence length 487
Comment (sp|Q9H2H9|S38A1_HUMAN) System N amino acid transporter 1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SLC38A1; OC=Catarrhini; Hominidae; Homo.
Sequence
MMHFKSGLELTELQNMTVPEDDNISNDSNDFTEVENGQINSKFISDRESRRSLTNSHLEK
KKCDEYIPGTTSLGMSVFNLSNAIMGSGILGLAFALANTGILLFLVLLTSVTLLSIYSIN
LLLICSKETGCMVYEKLGEQVFGTTGKFVIFGATSLQNTGAMLSYLFIVKNELPSAIKFL
MGKEETFSAWYVDGRVLVVIVTFGIILPLCLLKNLGYLGYTSGFSLSCMVFFLIVVIYKK
FQIPCIVPELNSTISANSTNADTCTPKYVTFNSKTVYALPTIAFAFVCHPSVLPIYSELK
DRSQKKMQMVSNISFFAMFVMYFLTAIFGYLTFYDNVQSDLLHKYQSKDDILILTVRLAV
IVAVILTVPVLFFTVRSSLFELAKKTKFNLCRHTVVTCILLVVINLLVIFIPSMKDIFGV
VGVTSANMLIFILPSSLYLKITDQDGDKGTQRIWAALFLGLGVLFSLVSIPLVIYDWACS
SSSDEGH
Download sequence
Identical sequences A0A024R124 G3QCR1 H2NH16 K7B6S6 Q9H2H9
ENSPPYP00000005062 NP_001070952.1.87134 NP_001070952.1.92137 NP_001265316.1.87134 NP_001265316.1.92137 NP_001265317.1.87134 NP_001265317.1.92137 NP_001265318.1.87134 NP_001265318.1.92137 NP_109599.3.87134 NP_109599.3.92137 XP_003825807.1.60992 XP_003825808.1.60992 XP_008949339.1.60992 XP_016779061.1.37143 XP_016779062.1.37143 XP_016779063.1.37143 XP_018894379.1.27298 XP_018894380.1.27298 ENSPPYP00000005062 gi|117168275|ref|NP_109599.3| gi|117168277|ref|NP_001070952.1| 9600.ENSPPYP00000005062 9606.ENSP00000381634 ENSP00000381634 ENSP00000398142 ENSP00000447853 ENSP00000449607 ENSP00000381634 ENSP00000398142 ENSP00000447853 ENSP00000449607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]