SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9H3R0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9H3R0
Domain Number 1 Region: 63-331
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 3.98e-40
Family PhyH-like 0.065
Further Details:      
 
Domain Number 2 Region: 879-935
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 8.65e-22
Family Tudor domain 0.00037
Further Details:      
 
Domain Number 3 Region: 936-991
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 8.17e-16
Family Tudor domain 0.00019
Further Details:      
 
Domain Number 4 Region: 711-749
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000598
Family PHD domain 0.015
Further Details:      
 
Weak hits

Sequence:  Q9H3R0
Domain Number - Region: 807-844
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0244
Family PHD domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9H3R0
Sequence length 1056
Comment (sp|Q9H3R0|KDM4C_HUMAN) Jumonji domain-containing protein 2C KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=KDM4C; OC=Catarrhini; Hominidae; Homo.
Sequence
MEVAEVESPLNPSCKIMTFRPSMEEFREFNKYLAYMESKGAHRAGLAKVIPPKEWKPRQC
YDDIDNLLIPAPIQQMVTGQSGLFTQYNIQKKAMTVKEFRQLANSGKYCTPRYLDYEDLE
RKYWKNLTFVAPIYGADINGSIYDEGVDEWNIARLNTVLDVVEEECGISIEGVNTPYLYF
GMWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAQGFFPSSSQGCDAFL
RHKMTLISPSVLKKYGIPFDKITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATVRWID
YGKVAKLCTCRKDMVKISMDIFVRKFQPDRYQLWKQGKDIYTIDHTKPTPASTPEVKAWL
QRRRKVRKASRSFQCARSTSKRPKADEEEEVSDEVDGAEVPNPDSVTDDLKVSEKSEAAV
KLRNTEASSEEESSASRMQVEQNLSDHIKLSGNSCLSTSVTEDIKTEDDKAYAYRSVPSI
SSEADDSIPLSSGYEKPEKSDPSELSWPKSPESCSSVAESNGVLTEGEESDVESHGNGLE
PGEIPAVPSGERNSFKVPSIAEGENKTSKSWRHPLSRPPARSPMTLVKQQAPSDEELPEV
LSIEEEVEETESWAKPLIHLWQTKSPNFAAEQEYNATVARMKPHCAICTLLMPYHKPDSS
NEENDARWETKLDEVVTSEGKTKPLIPEMCFIYSEENIEYSPPNAFLEEDGTSLLISCAK
CCVRVHASCYGIPSHEICDGWLCARCKRNAWTAECCLCNLRGGALKQTKNNKWAHVMCAV
AVPEVRFTNVPERTQIDVGRIPLQRLKLKCIFCRHRVKRVSGACIQCSYGRCPASFHVTC
AHAAGVLMEPDDWPYVVNITCFRHKVNPNVKSKACEKVISVGQTVITKHRNTRYYSCRVM
AVTSQTFYEVMFDDGSFSRDTFPEDIVSRDCLKLGPPAEGEVVQVKWPDGKLYGAKYFGS
NIAHMYQVEFEDGSQIAMKREDIYTLDEELPKRVKARFSTASDMRFEDTFYGADIIQGER
KRQRVLSSRFKNEYVADPVYRTFLKSSFQKKCQKRQ
Download sequence
Identical sequences Q9H3R0
HR6541 ENSP00000383990 gi|109255247|ref|NP_055876.2| ENSP00000370710 NP_055876.2.87134 NP_055876.2.92137 9606.ENSP00000370710 ENSP00000370710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]