SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9H790 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9H790
Sequence length 373
Comment (sp|Q9H790|EXO5_HUMAN) Defects in morphology protein 1 homolog KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=EXO5; OC=Catarrhini; Hominidae; Homo.
Sequence
MAETREEETVSAEASGFSDLSDSEFLEFLDLEDAQESKALVNMPGPSSESLGKDDKPISL
QNWKRGLDILSPMERFHLKYLYVTDLATQNWCELQTAYGKELPGFLAPEKAAVLDTGASI
HLARELELHDLVTVPVTTKEDAWAIKFLNILLLIPTLQSEGHIREFPVFGEGEGVLLVGV
IDELHYTAKGELELAELKTRRRPMLPLEAQKKKDCFQVSLYKYIFDAMVQGKVTPASLIH
HTKLCLEKPLGPSVLRHAQQGGFSVKSLGDLMELVFLSLTLSDLPVIDILKIEYIHQETA
TVLGTEIVAFKEKEVRAKVQHYMAYWMGHREPQGVDVEEAWKCRTCTYADICEWRKGSGV
LSSTLAPQVKKAK
Download sequence
Identical sequences Q9H790
ENSP00000296380 ENSP00000351328 ENSP00000361788 NP_073611.1.87134 NP_073611.1.92137 XP_005271182.1.92137 XP_005271183.1.92137 XP_005271185.1.92137 XP_011540272.1.92137 XP_016857588.1.92137 XP_016857589.1.92137 XP_016857590.1.92137 XP_016857591.1.92137 XP_016857592.1.92137 XP_016857593.1.92137 9606.ENSP00000296380 ENSP00000296380 ENSP00000351328 ENSP00000361788 ENSP00000296380 gi|12232457|ref|NP_073611.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]