SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9H9B4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9H9B4
Sequence length 322
Comment (sp|Q9H9B4|SFXN1_HUMAN) Tricarboxylate carrier protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SFXN1; OC=Catarrhini; Hominidae; Homo.
Sequence
MSGELPPNINIKEPRWDQSTFIGRANHFFTVTDPRNILLTNEQLESARKIVHDYRQGIVP
PGLTENELWRAKYIYDSAFHPDTGEKMILIGRMSAQVPMNMTITGCMMTFYRTTPAVLFW
QWINQSFNAVVNYTNRSGDAPLTVNELGTAYVSATTGAVATALGLNALTKHVSPLIGRFV
PFAAVAAANCINIPLMRQRELKVGIPVTDENGNRLGESANAAKQAITQVVVSRILMAAPG
MAIPPFIMNTLEKKAFLKRFPWMSAPIQVGLVGFCLVFATPLCCALFPQKSSMSVTSLEA
ELQAKIQESHPELRRVYFNKGL
Download sequence
Identical sequences G1QIB8 G3QYR9 H2PHF3 Q9H9B4
ENSNLEP00000000661 ENSGGOP00000008011 gi|23618867|ref|NP_073591.2| ENSP00000316905 ENSP00000316905 ENSNLEP00000000661 ENSPPYP00000017977 ENSP00000420961 ENSPPYP00000017977 NP_001309906.1.87134 NP_001309906.1.92137 NP_073591.2.87134 NP_073591.2.92137 XP_003273304.1.23891 XP_004043083.1.27298 XP_009239575.1.23681 ENSGGOP00000008011 9600.ENSPPYP00000017977 9606.ENSP00000316905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]