SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9H9B4 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9H9B4
Sequence length 322
Comment (sp|Q9H9B4|SFXN1_HUMAN) Tricarboxylate carrier protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SFXN1; OC=Catarrhini; Hominidae; Homo.
Sequence
MSGELPPNINIKEPRWDQSTFIGRANHFFTVTDPRNILLTNEQLESARKIVHDYRQGIVP
PGLTENELWRAKYIYDSAFHPDTGEKMILIGRMSAQVPMNMTITGCMMTFYRTTPAVLFW
QWINQSFNAVVNYTNRSGDAPLTVNELGTAYVSATTGAVATALGLNALTKHVSPLIGRFV
PFAAVAAANCINIPLMRQRELKVGIPVTDENGNRLGESANAAKQAITQVVVSRILMAAPG
MAIPPFIMNTLEKKAFLKRFPWMSAPIQVGLVGFCLVFATPLCCALFPQKSSMSVTSLEA
ELQAKIQESHPELRRVYFNKGL
Download sequence
Identical sequences G1QIB8 G3QYR9 H2PHF3 Q9H9B4
ENSPPYP00000017977 ENSP00000316905 ENSP00000420961 gi|23618867|ref|NP_073591.2| 9600.ENSPPYP00000017977 9606.ENSP00000316905 ENSNLEP00000000661 ENSNLEP00000000661 ENSGGOP00000008011 ENSP00000316905 ENSPPYP00000017977 ENSGGOP00000008011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]