SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9HA82 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9HA82
Domain Number 1 Region: 70-126
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000077
Family Homeodomain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
endocrine system development 1.681 40.61
cell fate specification 1.993 36.66
cell fate commitment 1.4 33.46
diencephalon development 2.237 30.86
forebrain development 1.469 29.05
endocrine pancreas development 1.998 28.42
pancreas development 1.741 26.94
regulation of cell fate commitment 2.15 24.05
gastrulation 1.536 23.99
regulation of apoptotic process 1.258 22.83
Cellular Component IC (bits) H-Score
protein-DNA complex 1.923 18.12
chromosomal part 1.512 12.74
nucleoplasm part 1.369 11.17
ATPase complex 2.002 11.05
nuclear transcription factor complex 2.016 8.32
chromosomal region 1.996 7.51
transferase complex 1.369 7.08
microtubule cytoskeleton 1.44 5.46
centrosome 2.023 5.46
nuclear chromosome part 1.842 4.92

Protein sequence

External link(s) Q9HA82
Sequence length 394
Comment (sp|Q9HA82|CERS4_HUMAN) LAG1 longevity assurance homolog 4 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CERS4; OC=Catarrhini; Hominidae; Homo.
Sequence
MLSSFNEWFWQDRFWLPPNVTWTELEDRDGRVYPHPQDLLAALPLALVLLAMRLAFERFI
GLPLSRWLGVRDQTRRQVKPNATLEKHFLTEGHRPKEPQLSLLAAQCGLTLQQTQRWFRR
RRNQDRPQLTKKFCEASWRFLFYLSSFVGGLSVLYHESWLWAPVMCWDRYPNQTLKPSLY
WWYLLELGFYLSLLIRLPFDVKRKDFKEQVIHHFVAVILMTFSYSANLLRIGSLVLLLHD
SSDYLLEACKMVNYMQYQQVCDALFLIFSFVFFYTRLVLFPTQILYTTYYESISNRGPFF
GYYFFNGLLMLLQLLHVFWSCLILRMLYSFMKKGQMEKDIRSDVEESDSSEEAAAAQEPL
QLKNGAAGGPRPAPTDGPRSRVAGRLTNRHTTAT
Download sequence
Identical sequences Q9HA82
ENSP00000251363 ENSP00000251363 ENSP00000453509 ENSP00000251363 ENSP00000453509 gi|205360977|ref|NP_078828.2| 9606.ENSP00000251363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]