SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9HA82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9HA82
Domain Number 1 Region: 70-126
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000077
Family Homeodomain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9HA82
Sequence length 394
Comment (sp|Q9HA82|CERS4_HUMAN) LAG1 longevity assurance homolog 4 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CERS4; OC=Catarrhini; Hominidae; Homo.
Sequence
MLSSFNEWFWQDRFWLPPNVTWTELEDRDGRVYPHPQDLLAALPLALVLLAMRLAFERFI
GLPLSRWLGVRDQTRRQVKPNATLEKHFLTEGHRPKEPQLSLLAAQCGLTLQQTQRWFRR
RRNQDRPQLTKKFCEASWRFLFYLSSFVGGLSVLYHESWLWAPVMCWDRYPNQTLKPSLY
WWYLLELGFYLSLLIRLPFDVKRKDFKEQVIHHFVAVILMTFSYSANLLRIGSLVLLLHD
SSDYLLEACKMVNYMQYQQVCDALFLIFSFVFFYTRLVLFPTQILYTTYYESISNRGPFF
GYYFFNGLLMLLQLLHVFWSCLILRMLYSFMKKGQMEKDIRSDVEESDSSEEAAAAQEPL
QLKNGAAGGPRPAPTDGPRSRVAGRLTNRHTTAT
Download sequence
Identical sequences Q9HA82
gi|205360977|ref|NP_078828.2| ENSP00000251363 9606.ENSP00000251363 NP_078828.2.87134 NP_078828.2.92137 XP_011526592.1.92137 XP_011526593.1.92137 XP_011526594.1.92137 XP_011526595.1.92137 XP_011526596.1.92137 XP_011526597.1.92137 XP_016882792.1.92137 XP_016882793.1.92137 XP_016882794.1.92137 ENSP00000251363 ENSP00000453509 ENSP00000251363 ENSP00000453509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]