SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9HCS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9HCS2
Domain Number 1 Region: 55-518
Classification Level Classification E-value
Superfamily Cytochrome P450 1.44e-122
Family Cytochrome P450 0.00000493
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9HCS2
Sequence length 524
Comment (sp|Q9HCS2|CP4FC_HUMAN) CYPIVF12 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CYP4F12; OC=Catarrhini; Hominidae; Homo.
Sequence
MSLLSLPWLGLRPVATSPWLLLLLVVGSWLLARILAWTYAFYNNCRRLQCFPQPPKRNWF
WGHLGLITPTEEGLKNSTQMSATYSQGFTIWLGPIIPFIVLCHPDTIRSITNASAAIAPK
DNLFIRFLKPWLGEGILLSGGDKWSRHRRMLTPAFHFNILKSYITIFNKSANIMLDKWQH
LASEGSSCLDMFEHISLMTLDSLQKCIFSFDSHCQERPSEYIATILELSALVEKRSQHIL
QHMDFLYYLSHDGRRFHRACRLVHDFTDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFID
VLLLSKDEDGKALSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQE
LLKDRDPKEIEWDDLAQLPFLTMCVKESLRLHPPAPFISRCCTQDIVLPDGRVIPKGITC
LIDIIGVHHNPTVWPDPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKV
VLALMLLHFRFLPDHTEPRRKLELIMRAEGGLWLRVEPLNVSLQ
Download sequence
Identical sequences Q9HCS2
ENSP00000321821 ENSP00000321821 ENSP00000448998 9606.ENSP00000321821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]