SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9NPG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9NPG1
Domain Number 1 Region: 27-144
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 3.4e-41
Family Frizzled cysteine-rich domain 0.0000543
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9NPG1
Sequence length 666
Comment (sp|Q9NPG1|FZD3_HUMAN) Frizzled-3 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FZD3; OC=Catarrhini; Hominidae; Homo.
Sequence
MAMTWIVFSLWPLTVFMGHIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAAL
AMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVP
WPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFL
HVRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIF
YAVCYMMVSLIFFIGFLLEDRVACNASIPAQYKASTVTQGSHNKACTMLFMILYFFTMAG
SVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGV
CFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR
IGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILF
LMKYLMALIVGIPSVFWVGSKKTCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDP
NTPIIRKSRGTSTQGTSTHASSTQLAMVDDQRSKAGSIHSKVSSYHGSLHRSRDGRYTPC
SYRGMEERLPHGSMSRLTDHSRHSSSHRLNEQSRHSSIRDLSNNPMTHITHGTSMNRVIE
EDGTSA
Download sequence
Identical sequences H2QVZ0 Q9NPG1
ENSPTRP00000034445 ENSP00000240093 ENSP00000240093 ENSP00000437489 ENSPTRP00000034445 ENSP00000240093 ENSP00000437489 gi|313851102|ref|NP_665873.1| gi|8393378|ref|NP_059108.1| NP_059108.1.87134 NP_059108.1.92137 NP_665873.1.87134 NP_665873.1.92137 XP_001166266.2.37143 XP_003830828.1.60992 XP_003830829.1.60992 XP_009453388.1.37143 XP_528098.1.37143 9598.ENSPTRP00000034445 9606.ENSP00000240093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]