SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9NQN1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9NQN1
Domain Number 1 Region: 5-316
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.01e-82
Family Rhodopsin-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9NQN1
Sequence length 319
Comment (sp|Q9NQN1|OR2S1_HUMAN) Olfactory receptor OR9-3 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=OR2S2; OC=Catarrhini; Hominidae; Homo.
Sequence
MEKANETSPVMGFVLLRLSAHPELEKTFFVLILLMYLVILLGNGVLILVTILDSRLHTPM
YFFLGNLSFLDICFTTSSVPLVLDSFLTPQETISFSACAVQMALSFAMAGTECLLLSMMA
FDRYVAICNPLRYSVIMSKAAYMPMAASSWAIGGAASVVHTSLAIQLPFCGDNVINHFTC
EILAVLKLACADISINVISMEVTNVIFLGVPVLFISFSYVFIITTILRIPSAEGRKKVFS
TCSAHLTVVIVFYGTLFFMYGKPKSKDSMGADKEDLSDKLIPLFYGVVTPMLNPIIYSLR
NKDVKAAVRRLLRPKGFTQ
Download sequence
Identical sequences Q9NQN1
ENSP00000344040 gi|167830488|ref|NP_063950.2| ENSP00000344040 NP_063950.2.87134 NP_063950.2.92137 9606.ENSP00000344040 ENSP00000344040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]