SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9NQX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9NQX3
Domain Number 1 Region: 319-496
Classification Level Classification E-value
Superfamily MoeA N-terminal region -like 2.88e-52
Family MoeA N-terminal region -like 0.0000000104
Further Details:      
 
Domain Number 2 Region: 14-170
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 5.89e-44
Family MogA-like 0.000000105
Further Details:      
 
Domain Number 3 Region: 499-651
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 3.14e-39
Family MoeA central domain-like 0.000000122
Further Details:      
 
Domain Number 4 Region: 654-734
Classification Level Classification E-value
Superfamily MoeA C-terminal domain-like 8.37e-26
Family MoeA C-terminal domain-like 0.00000391
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9NQX3
Sequence length 736
Comment (sp|Q9NQX3|GEPH_HUMAN) Domain E KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GPHN OC=Catarrhini; Hominidae; Homo.
Sequence
MATEGMILTNHDHQIRVGVLTVSDSCFRNLAEDRSGINLKDLVQDPSLLGGTISAYKIVP
DEIEEIKETLIDWCDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSL
NVTPLGMLSRPVCGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLRDAIVKVKEVH
DELEDLPSPPPPLSPPPTTSPHKQTEDKGVQCEEEEEEKKDSGVASTEDSSSSHITAAAI
AAKIPDSIISRGVQVLPRDTASLSTTPSESPRAQATSRLSTASCPTPKVQSRCSSKENIL
RASHSAVDITKVARRHRMSPFPLTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVY
AKDNLPPFPASVKDGYAVRAADGPGDRFIIGESQAGEQPTQTVMPGQVMRVTTGAPIPCG
ADAVVQVEDTELIRESDDGTEELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPS
EIGLLATVGVTEVEVNKFPVVAVMSTGNELLNPEDDLLPGKIRDSNRSTLLATIQEHGYP
TINLGIVGDNPDDLLNALNEGISRADVIITSGGVSMGEKDYLKQVLDIDLHAQIHFGRVF
MKPGLPTTFATLDIDGVRKIIFALPGNPVSAVVTCNLFVVPALRKMQGILDPRPTIIKAR
LSCDVKLDPRPEYHRCILTWHHQEPLPWAQSTGNQMSSRLMSMRSANGLLMLPPKTEQYV
ELHKGEVVDVMVIGRL
Download sequence
Identical sequences A0A1S2ZWZ2 A0A2J8PIJ7 A0A2J8WM09 F1SA44 F6UFQ5 H9FNK4 Q9NQX3
ENSMMUP00000032862 gi|66932975|ref|NP_001019389.1| ENSP00000312771 NP_001019389.1.87134 NP_001019389.1.92137 NP_001244744.1.72884 XP_001135627.2.37143 XP_001369878.1.35504 XP_002754065.1.60252 XP_003435080.1.84170 XP_003586639.1.76553 XP_003824107.1.60992 XP_003924493.1.74449 XP_004010776.1.66739 XP_004087211.1.23891 XP_004262187.1.21590 XP_004371017.1.4749 XP_004397631.1.74151 XP_004426313.1.5094 XP_004584526.1.84141 XP_004612405.1.94378 XP_004739023.1.14098 XP_004837435.1.39548 XP_005343306.1.66349 XP_005399157.1.28644 XP_005561590.1.63531 XP_005877968.1.60319 XP_006091049.1.53796 XP_006973193.1.50099 XP_007184378.1.59432 XP_007525884.1.11023 XP_007985212.1.81039 XP_008850364.1.79516 XP_010643624.1.5607 XP_011281585.1.62641 XP_011382515.1.92234 XP_011805106.1.43180 XP_011849636.1.47321 XP_011909237.1.92194 XP_011971092.1.54773 XP_012293465.1.9421 XP_014716406.1.49734 XP_015320680.1.59421 XP_015447464.1.64745 XP_015986729.1.101085 XP_017909547.1.57651 XP_018864921.1.27298 XP_019307071.1.44245 XP_019589180.1.88060 XP_019777987.1.83887 XP_020141323.1.48125 XP_020953682.1.46622 ENSP00000312771 ENSCJAP00000028681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]