SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9NR64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9NR64
Domain Number 1 Region: 460-658
Classification Level Classification E-value
Superfamily Kelch motif 3.14e-62
Family Kelch motif 0.0000143
Further Details:      
 
Domain Number 2 Region: 193-307
Classification Level Classification E-value
Superfamily POZ domain 3.92e-33
Family BTB/POZ domain 0.0018
Further Details:      
 
Domain Number 3 Region: 631-745
Classification Level Classification E-value
Superfamily Kelch motif 3.92e-33
Family Kelch motif 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9NR64
Sequence length 748
Comment (sp|Q9NR64|KLHL1_HUMAN) Kelch-like protein 1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=KLHL1; OC=Catarrhini; Hominidae; Homo.
Sequence
MSGSGRKDFDVKHILRLRWKLFSHPSPSTGGPAGGGCLQQDGSGSFEHWGPSQSRLLKSQ
ERSGVSTFWKKPSSSSSSSSSPSSSSSSFNPLNGTLLPVATRLQQGAPGQGTQQPARTLF
YVESLEEEVVPGMDFPGPHEKGLVLQELKVEPDNSSQATGEGCGHRLSSTGHSMTPQSDL
DSSSSEEFYQAVHHAEQTFRKMESYLKQQQLCDVILIVGNRKIPAHRLVLSSVSDYFAAM
FTSDVCEAKQEEIKMEGIDPNALWDLVQFAYTGCLELKEDTIENLLAAACLLQLPQVVEV
CCHFLMKLLHPSNCLGIRAFADAQGCIELMKVAHSYTMENIMEVIRNQEFLLLPAEELHK
LLASDDVNVPDEETIFHALMMWVKYDMQSRCNDLSMLLAFIRLPLLPPQILADLENHALF
KNDLECQKLILEAMKYHLLPERRTLMQSPRTKPRKSTVGTLYAVGGMDNNKGATTIEKYD
LRTNLWIQAGMMNGRRLQFGVAVIDDKLFVIGGRDGLKTLNTVECYNPKTKTWTVLPPMS
THRHGLGVTVLEGPIYAVGGHDGWSYLNTVERWDPQSQQWTFVASMSIARSTVGVAALNG
KLYSVGGRDGSSCLSSMEYYDPHTNKWNMCAPMCKRRGGVGVATCDGFLYAVGGHDAPAS
NHCSRLLDYVERYDPKTDTWTMVAPLSMPRDAVGVCLLGDRLYAVGGYDGQTYLNTMESY
DPQTNEWTQMASLNIGRAGACVVVIKQP
Download sequence
Identical sequences G3RGN1 Q9NR64
9606.ENSP00000367075 ENSGGOP00000014781 ENSP00000367075 ENSP00000367075 gi|14780904|ref|NP_065917.1| ENSP00000367075 ENSGGOP00000014781 NP_065917.1.87134 NP_065917.1.92137 XP_018895426.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]