SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9NR81 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9NR81
Domain Number 1 Region: 104-313
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-54
Family DBL homology domain (DH-domain) 0.0000597
Further Details:      
 
Domain Number 2 Region: 324-447
Classification Level Classification E-value
Superfamily PH domain-like 1.56e-19
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ruffle 1.819 36.91
cell leading edge 1.426 35.47
cytoplasmic region 1.567 27.06
cell-substrate junction 1.548 21.31
focal adhesion 1.815 21.31
cytosol 1.295 18.5
cell surface 1.3 16.35
plasma membrane protein complex 1.527 16.33
cell division site 2.125 16.07
cytoplasmic side of membrane 1.952 15.41

Protein sequence

External link(s) Q9NR81
Sequence length 526
Comment (sp|Q9NR81|ARHG3_HUMAN) Exchange factor found in platelets and leukemic and neuronal tissues KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ARHGEF3; OC=Catarrhini; Hominidae; Homo.
Sequence
MVAKDYPFYLTVKRANCSLELPPASGPAKDAEEPSNKRVKPLSRVTSLANLIPPVKATPL
KRFSQTLQRSISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQMLTSKE
IKRQEAIFELSQGEEDLIEDLKLAKKAYHDPMLKLSIMTEQELNQIFGTLDSLIPLHEEL
LSQLRDVRKPDGSTEHVGPILVGWLPCLSSYDSYCSNQVAAKALLDHKKQDHRVQDFLQR
CLESPFSRKLDLWNFLDIPRSRLVKYPLLLREILRHTPNDNPDQQHLEEAINIIQGIVAE
INTKTGESECRYYKERLLYLEEGQKDSLIDSSRVLCCHGELKNNRGVKLHVFLFQEVLVI
TRAVTHNEQLCYQLYRQPIPVKDLLLEDLQDGEVRLGGSLRGAFSNNERIKNFFRVSFKN
GSQSQTHSLQANDTFNKQQWLNCIRQAKETVLCAAGQAGVLDSEGSFLNPTTGSRELQGE
TKLEQMDQSDSESDCSMDTSEVSLDCERMEQTDSSCGNSRHGESNV
Download sequence
Identical sequences G3SD09 H2PAG2 K7ALL1 Q9NR81
gi|9506401|ref|NP_062455.1| ENSGGOP00000025987 ENSPPYP00000015414 ENSP00000296315 ENSP00000296315 ENSPPYP00000015414 HR2945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]