SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9NR81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9NR81
Domain Number 1 Region: 104-313
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-54
Family DBL homology domain (DH-domain) 0.0000597
Further Details:      
 
Domain Number 2 Region: 324-447
Classification Level Classification E-value
Superfamily PH domain-like 1.56e-19
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9NR81
Sequence length 526
Comment (sp|Q9NR81|ARHG3_HUMAN) Exchange factor found in platelets and leukemic and neuronal tissues KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ARHGEF3; OC=Catarrhini; Hominidae; Homo.
Sequence
MVAKDYPFYLTVKRANCSLELPPASGPAKDAEEPSNKRVKPLSRVTSLANLIPPVKATPL
KRFSQTLQRSISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQMLTSKE
IKRQEAIFELSQGEEDLIEDLKLAKKAYHDPMLKLSIMTEQELNQIFGTLDSLIPLHEEL
LSQLRDVRKPDGSTEHVGPILVGWLPCLSSYDSYCSNQVAAKALLDHKKQDHRVQDFLQR
CLESPFSRKLDLWNFLDIPRSRLVKYPLLLREILRHTPNDNPDQQHLEEAINIIQGIVAE
INTKTGESECRYYKERLLYLEEGQKDSLIDSSRVLCCHGELKNNRGVKLHVFLFQEVLVI
TRAVTHNEQLCYQLYRQPIPVKDLLLEDLQDGEVRLGGSLRGAFSNNERIKNFFRVSFKN
GSQSQTHSLQANDTFNKQQWLNCIRQAKETVLCAAGQAGVLDSEGSFLNPTTGSRELQGE
TKLEQMDQSDSESDCSMDTSEVSLDCERMEQTDSSCGNSRHGESNV
Download sequence
Identical sequences G3SD09 H2PAG2 H2QMT7 Q9NR81
ENSP00000296315 gi|9506401|ref|NP_062455.1| HR2945 ENSP00000296315 NP_062455.1.87134 NP_062455.1.92137 XP_003309885.1.37143 XP_003776266.1.23681 XP_003818761.1.60992 XP_004034389.1.27298 ENSPPYP00000015414 ENSPPYP00000015414 ENSGGOP00000025987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]