SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9NRE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9NRE1
Domain Number 1 Region: 94-254
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.09e-56
Family Matrix metalloproteases, catalytic domain 0.0000181
Further Details:      
 
Weak hits

Sequence:  Q9NRE1
Domain Number - Region: 20-86
Classification Level Classification E-value
Superfamily PGBD-like 0.000451
Family MMP N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9NRE1
Sequence length 261
Comment (sp|Q9NRE1|MMP26_HUMAN) Matrilysin-2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=MMP26; OC=Catarrhini; Hominidae; Homo.
Sequence
MQLVILRVTIFLPWCFAVPVPPAADHKGWDFVEGYFHQFFLTKKESPLLTQETQTQLLQQ
FHRNGTDLLDMQMHALLHQPHCGVPDGSDTSISPGRCKWNKHTLTYRIINYPHDMKPSAV
KDSIYNAVSIWSNVTPLIFQQVQNGDADIKVSFWQWAHEDGWPFDGPGGILGHAFLPNSG
NPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQL
SADDIQRIQHLYGEKCSSDIP
Download sequence
Identical sequences Q9NRE1
ENSP00000300762 ENSP00000369753 ENSP00000300762 ENSP00000369753 gi|73808266|ref|NP_068573.2| ENSP00000300762 GO.101538 MPIB-421 9606.ENSP00000300762 NP_068573.2.87134 NP_068573.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]