SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9NRP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9NRP2
Sequence length 79
Comment (sp|Q9NRP2|COXM2_HUMAN) COX assembly mitochondrial protein 2 homolog KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CMC2; OC=Catarrhini; Hominidae; Homo.
Sequence
MHPDLSPHLHTEECNVLINLLKECHKNHNILKFFGYCNDVDRELRKCLKNEYVENRTKSR
EHGIAMRKKLFNPPEESEK
Download sequence
Identical sequences Q9NRP2
ENSP00000219400 ENSP00000455723 ENSP00000456841 NP_064573.1.87134 NP_064573.1.92137 XP_016878956.1.92137 XP_016878957.1.92137 XP_016878958.1.92137 XP_016878959.1.92137 9606.ENSP00000219400 ENSP00000219400 ENSP00000455457 ENSP00000455723 ENSP00000456841 gi|9910184|ref|NP_064573.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]