SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9NV31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9NV31
Domain Number 1 Region: 30-174
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.000000000000048
Family Ribosomal protein S4 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9NV31
Sequence length 184
Comment (sp|Q9NV31|IMP3_HUMAN) BRMS2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=IMP3; OC=Catarrhini; Hominidae; Homo.
Sequence
MVRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQLSRAVRELAR
RLRDLPERDQFRVRASAALLDKLYALGLVPTRGSLELCDFVTASSFCRRRLPTVLLKLRM
AQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDF
DLEA
Download sequence
Identical sequences A0A096NB33 A0A0D9SED8 A0A2I2ZCU7 A0A2K5HLX2 A0A2K5KU73 A0A2K6B368 F7GL33 G8F2V1 H2Q9U5 Q9NV31
ENSGGOP00000007175 GO.35202 gi|8922794|ref|NP_060755.1| NP_001248641.1.72884 NP_060755.1.87134 NP_060755.1.92137 XP_003819012.1.60992 XP_003952757.1.37143 XP_004056601.1.27298 XP_005560177.1.63531 XP_008014011.1.81039 XP_011755336.1.29376 XP_011788254.1.43180 XP_011894176.1.92194 ENSPTRP00000012494 Hs8922794___KOG4655 ENSP00000326981 ENSP00000385217 ENSPANP00000009940 ENSP00000326981 ENSPTRP00000012494 9544.ENSMMUP00000021183 9598.ENSPTRP00000012494 9606.ENSP00000326981 ENSGGOP00000007175 ENSMMUP00000021182 ENSMMUP00000021183 ENSP00000326981 ENSP00000385217 ENSMMUP00000021182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]