SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9NWS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9NWS0
Sequence length 290
Comment (sp|Q9NWS0|PIHD1_HUMAN) Nucleolar protein 17 homolog KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PIH1D1; OC=Catarrhini; Hominidae; Homo.
Sequence
MANPKLLGMGLSEAEAIGADSARFEELLLQASKELQQAQTTRPESTQIQPQPGFCIKTNS
SEGKVFINICHSPSIPPPADVTEEELLQMLEEDQAGFRIPMSLGEPHAELDAKGQGCTAY
DVAVNSDFYRRMQNSDFLRELVITIAREGLEDKYNLQLNPEWRMMKNRPFMGSISQQNIR
SEQRPRIQELGDLYTPAPGRAESGPEKPHLNLWLEAPDLLLAEVDLPKLDGALGLSLEIG
ENRLVMGGPQQLYHLDAYIPLQINSHESKAAFHRKRKQLMVAMPLLPVPS
Download sequence
Identical sequences Q9NWS0
ENSP00000262265 ENSP00000470445 gi|8923598|ref|NP_060386.1| ENSP00000262265 9606.ENSP00000262265 NP_060386.1.87134 NP_060386.1.92137 HR962 ENSP00000262265 ENSP00000470445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]