SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9NWS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q9NWS6
Domain Number - Region: 28-51,85-237
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.00621
Family Sir2 family of transcriptional regulators 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9NWS6
Sequence length 357
Comment (sp|Q9NWS6|F118A_HUMAN) Protein FAM118A KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FAM118A; OC=Catarrhini; Hominidae; Homo.
Sequence
MDSVEKTTNRSEQKSRKFLKSLIRKQPQELLLVIGTGVSAAVAPGIPALCSWRSCIEAVI
EAAEQLEVLHPGDVAEFRRKVTKDRDLLVVAHDLIRKMSPRTGDAKPSFFQDCLMEVFDD
LEQHIRSPVVLQSILSLMDRGAMVLTTNYDNLLEAFGRRQNKPMESLDLKDKTKVLEWAR
GHMKYGVLHIHGLYTDPCGVVLDPSGYKDVTQDAEVMEVLQNLYRTKSFLFVGCGETLRD
QIFQALFLYSVPNKVDLEHYMLVLKENEDHFFKHQADMLLHGIKVVSYGDCFDHFPGYVQ
DLATQICKQQSPDADRVDSTTLLGNACQDCAKRKLEENGIEVSKKRTQSDTDDAGGS
Download sequence
Identical sequences A0A024R4V3 Q9NWS6
ENSP00000216214 NP_001098065.1.87134 NP_001098065.1.92137 NP_060381.2.87134 NP_060381.2.92137 ENSP00000216214 ENSP00000395892 gi|157388971|ref|NP_001098065.1| gi|157388973|ref|NP_060381.2| ENSP00000216214 ENSP00000395892 9606.ENSP00000216214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]