SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9NWU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9NWU5
Domain Number 1 Region: 54-176
Classification Level Classification E-value
Superfamily Ribosomal protein L22 1.31e-34
Family Ribosomal protein L22 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9NWU5
Sequence length 206
Comment (sp|Q9NWU5|RM22_HUMAN) Mitochondrial large ribosomal subunit protein uL22m {ECO:0000303|PubMed:25278503} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=MRPL22; OC=Catarrhini; Hominidae; Homo.
Sequence
MAAAVLGQLGALWIHNLRSRGKLALGVLPQSYIHTSASLDISRKWEKKNKIVYPPQLPGE
PRRPAEIYHCRRQIKYSKDKMWYLAKLIRGMSIDQALAQLEFNDKKGAKIIKEVLLEAQD
MAVRDHNVEFRSNLYIAESTSGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPPP
EPPKTAVAHAKEYIQQLRSRTIVHTL
Download sequence
Identical sequences A0A2I3GUV3 Q9NWU5
ENSP00000431040 ENSNLEP00000020255 ENSP00000431040 ENSNLEP00000020255 9606.ENSP00000411177 gi|21265040|ref|NP_054899.2| NP_054899.2.87134 NP_054899.2.92137 XP_003276620.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]