SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9NWU5 from Uniprot 2017_06 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9NWU5
Domain Number 1 Region: 54-176
Classification Level Classification E-value
Superfamily Ribosomal protein L22 1.31e-34
Family Ribosomal protein L22 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
structural constituent of ribosome 1.959 25.35
Biological Process IC (bits) H-Score
translation 1.514 17.32
ribosome biogenesis 1.853 13.41
ribonucleoprotein complex biogenesis 1.7 11.43
ncRNA metabolic process 1.491 6.88
rRNA metabolic process 2.071 6.88
RNA processing 1.499 4.9
ncRNA processing 1.837 4.9
mitochondrial gene expression 2.033 4.83
Cellular Component IC (bits) H-Score
ribosomal subunit 1.983 37.62
intracellular ribonucleoprotein complex 1.368 20.06
organellar ribosome 2.107 16.95
mitochondrial matrix 1.611 8.77
cytosol 1.295 7.98

Protein sequence

External link(s) Q9NWU5
Sequence length 206
Comment (sp|Q9NWU5|RM22_HUMAN) Mitochondrial large ribosomal subunit protein uL22m {ECO:0000303|PubMed:25278503} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=MRPL22; OC=Catarrhini; Hominidae; Homo.
Sequence
MAAAVLGQLGALWIHNLRSRGKLALGVLPQSYIHTSASLDISRKWEKKNKIVYPPQLPGE
PRRPAEIYHCRRQIKYSKDKMWYLAKLIRGMSIDQALAQLEFNDKKGAKIIKEVLLEAQD
MAVRDHNVEFRSNLYIAESTSGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPPP
EPPKTAVAHAKEYIQQLRSRTIVHTL
Download sequence
Identical sequences G1S417 Q9NWU5
ENSP00000431040 ENSP00000431040 gi|21265040|ref|NP_054899.2| 9606.ENSP00000411177 ENSNLEP00000020255 ENSNLEP00000020255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]