SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9NWW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9NWW6
Domain Number 1 Region: 4-187
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.88e-24
Family Phosphoribulokinase/pantothenate kinase 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9NWW6
Sequence length 199
Comment (sp|Q9NWW6|NRK1_HUMAN) Ribosylnicotinic acid kinase 1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=NMRK1; OC=Catarrhini; Hominidae; Homo.
Sequence
MKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEA
LNMEKMMSAISCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRSYFLTI
PYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQ
VYEDLIQELAKQKCLQVTA
Download sequence
Identical sequences Q9NWW6
NP_060351.1.87134 NP_060351.1.92137 XP_006717226.1.92137 XP_016870359.1.92137 ENSP00000354387 9606.ENSP00000354387 2qg6_A 2ql6_A 2ql6_B 2ql6_C 2ql6_D 2ql6_E 2ql6_F 2ql6_G 2ql6_H 2ql6_I 2ql6_J 2ql6_K 2ql6_L 2ql6_M 2ql6_N 2ql6_O 2ql6_P 400305 GO.35278 HR2946 ENSP00000354387 gi|8923530|ref|NP_060351.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]