SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9NWZ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9NWZ3
Domain Number 1 Region: 156-454
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-74
Family Protein kinases, catalytic subunit 0.0000593
Further Details:      
 
Domain Number 2 Region: 1-114
Classification Level Classification E-value
Superfamily DEATH domain 1.71e-38
Family DEATH domain, DD 0.00000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9NWZ3
Sequence length 460
Comment (sp|Q9NWZ3|IRAK4_HUMAN) Renal carcinoma antigen NY-REN-64 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=IRAK4; OC=Catarrhini; Hominidae; Homo.
Sequence
MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALL
QTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITV
QQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNF
DERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKC
QHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGIN
FLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEAL
RGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMND
ADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS
Download sequence
Identical sequences Q69FE3 Q9NWZ3
9606.ENSP00000349096 gi|166795293|ref|NP_057207.2| gi|166795295|ref|NP_001107654.1| HR6391 ENSP00000390327 NP_001107654.1.87134 NP_001107654.1.92137 NP_057207.2.87134 NP_057207.2.92137 XP_005269000.1.92137 XP_005269001.1.92137 XP_005269002.1.92137 XP_006719501.1.92137 XP_011536733.1.92137 XP_011536734.1.92137 XP_011536735.1.92137 XP_016874879.1.92137 ENSP00000390651 ENSP00000446490 ENSP00000390651 ENSP00000446490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]