SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9NX18 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9NX18
Domain Number 1 Region: 61-143
Classification Level Classification E-value
Superfamily YgfY-like 3.79e-22
Family YgfY-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9NX18
Sequence length 166
Comment (sp|Q9NX18|SDHF2_HUMAN) Succinate dehydrogenase assembly factor 2, mitochondrial {ECO:0000255|HAMAP-Rule:MF_03057} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=C11orf79, OC=Catarrhini; Hominidae; Homo.
Sequence
MAVSTVFSTSSLMLALSRHSLLSPLLSVTSFRRFYRGDSPTDSQKDMIEIPLPPWQERTD
ESIETKRARLLYESRKRGMLENCILLSLFAKEHLQHMTEKQLNLYDRLINEPSNDWDIYY
WATEAKPAPEIFENEVMALLRDFAKNKNKEQRLRAPDLEYLFEKPR
Download sequence
Identical sequences Q9NX18
ENSP00000301761 ENSP00000301761 9606.ENSP00000301761 NP_060311.1.87134 NP_060311.1.92137 HR6592 ENSP00000301761 gi|8923450|ref|NP_060311.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]