SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9NYL2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9NYL2
Domain Number 1 Region: 8-260
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.82e-78
Family Protein kinases, catalytic subunit 0.0000187
Further Details:      
 
Domain Number 2 Region: 335-408
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000329
Family SAM (sterile alpha motif) domain 0.031
Further Details:      
 
Weak hits

Sequence:  Q9NYL2
Domain Number - Region: 286-325
Classification Level Classification E-value
Superfamily Tropomyosin 0.0523
Family Tropomyosin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9NYL2
Sequence length 800
Comment (sp|Q9NYL2|M3K20_HUMAN) Sterile alpha motif- and leucine zipper-containing kinase AZK KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=MLTK, OC=Catarrhini; Hominidae; Homo.
Sequence
MSSLGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVL
SHRNIIQFYGVILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHY
LHMEAPVKVIHRDLKSRNVVIAADGVLKICDFGASRFHNHTTHMSLVGTFPWMAPEVIQS
LPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVAWLVVEKNERLTIPSSCPRSFAELLH
QCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIEATLERLKKLERD
LSFKEQELKERERRLKMWEQKLTEQSNTPLLPSFEIGAWTEDDVYCWVQQLVRKGDSSAE
MSVYASLFKENNITGKRLLLLEEEDLKDMGIVSKGHIIHFKSAIEKLTHDYINLFHFPPL
IKDSGGEPEENEEKIVNLELVFGFHLKPGTGPQDCKWKMYMEMDGDEIAITYIKDVTFNT
NLPDAEILKMTKPPFVMEKWIVGIAKSQTVECTVTYESDVRTPKSTKHVHSIQWSRTKPQ
DEVKAVQLAIQTLFTNSDGNPGSRSDSSADCQWLDTLRMRQIASNTSLQRSQSNPILGSP
FFSHFDGQDSYAAAVRRPQVPIKYQQITPVNQSRSSSPTQYGLTKNFSSLHLNSRDSGFS
SGNTDTSSERGRYSDRSRNKYGRGSISLNSSPRGRYSGKSQHSTPSRGRYPGKFYRVSQS
ALNPHQSPDFKRSPRDLHQPNTIPGMPLHPETDSRASEEDSKVSEGGWTKVEYRKKPHRP
SPAKTNKERARGDHRGWRNF
Download sequence
Identical sequences Q9NYL2
ENSP00000364361 ENSP00000364361 ENSP00000387259 NP_057737.2.87134 NP_057737.2.92137 XP_005246697.1.92137 9606.ENSP00000364361 ENSP00000364361 ENSP00000387259 gi|82880648|ref|NP_057737.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]