SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9NYW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9NYW2
Domain Number 1 Region: 7-305
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 8.79e-26
Family Rhodopsin-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9NYW2
Sequence length 309
Comment (sp|Q9NYW2|TA2R8_HUMAN) Taste receptor family B member 5 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=TAS2R8; OC=Catarrhini; Hominidae; Homo.
Sequence
MFSPADNIFIILITGEFILGILGNGYIALVNWIDWIKKKKISTVDYILTNLVIARICLIS
VMVVNGIVIVLNPDVYTKNKQQIVIFTFWTFANYLNMWITTCLNVFYFLKIASSSHPLFL
WLKWKIDMVVHWILLGCFAISLLVSLIAAIVLSCDYRFHAIAKHKRNITEMFHVSKIPYF
EPLTLFNLFAIVPFIVSLISFFLLVRSLWRHTKQIKLYATGSRDPSTEVHVRAIKTMTSF
IFFFFLYYISSILMTFSYLMTKYKLAVEFGEIAAILYPLGHSLILIVLNNKLRQTFVRML
TCRKIACMI
Download sequence
Identical sequences Q9NYW2
ENSP00000240615 ENSP00000459504 ENSP00000461158 9606.ENSP00000240615 ENSP00000240615 ENSP00000459504 ENSP00000461158 gi|12965174|ref|NP_076407.1| NP_076407.1.87134 NP_076407.1.92137 ENSP00000240615 ENSP00000461158 ENSP00000484163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]