SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9NZD8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9NZD8
Domain Number 1 Region: 20-266
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.36e-25
Family Haloperoxidase 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9NZD8
Sequence length 308
Comment (sp|Q9NZD8|SPG21_HUMAN) Spastic paraplegia 21 protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SPG21; OC=Catarrhini; Hominidae; Homo.
Sequence
MGEIKVSPDYNWFRGTVPLKKIIVDDDDSKIWSLYDAGPRSIRCPLIFLPPVSGTADVFF
RQILALTGWGYRVIALQYPVYWDHLEFCDGFRKLLDHLQLDKVHLFGASLGGFLAQKFAE
YTHKSPRVHSLILCNSFSDTSIFNQTWTANSFWLMPAFMLKKIVLGNFSSGPVDPMMADA
IDFMVDRLESLGQSELASRLTLNCQNSYVEPHKIRDIPVTIMDVFDQSALSTEAKEEMYK
LYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGS
LGISQEEQ
Download sequence
Identical sequences A0A024R5Y1 A0A2I3HT09 G3QQ10 H2NNH7 H2Q9L5 Q9NZD8
ENSPTRP00000012254 ENSPPYP00000007438 ENSNLEP00000015285 ENSP00000204566 ENSP00000404111 ENSPPYP00000007438 ENSPPYP00000024383 ENSP00000204566 9598.ENSPTRP00000012254 9600.ENSPPYP00000007438 9606.ENSP00000204566 ENSNLEP00000015285 gi|189217845|ref|NP_001121361.1| gi|7706174|ref|NP_057714.1| NP_001121361.1.87134 NP_001121361.1.92137 NP_057714.1.87134 NP_057714.1.92137 XP_003267148.1.23891 XP_003267149.1.23891 XP_003314760.1.37143 XP_004056380.1.27298 XP_005254494.1.92137 XP_009248181.1.23681 XP_009427621.1.37143 XP_012362903.1.23891 XP_016877786.1.92137 XP_016877787.1.92137 XP_018866681.1.27298 XP_018866682.1.27298 XP_510477.3.37143 ENSPTRP00000012254 ENSGGOP00000004667 ENSP00000204566 ENSP00000404111 ENSGGOP00000004667 400313 GO.36451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]