SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9NZQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9NZQ3
Domain Number 1 Region: 1-63
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000289
Family SH3-domain 0.0012
Further Details:      
 
Weak hits

Sequence:  Q9NZQ3
Domain Number - Region: 411-559,649-693
Classification Level Classification E-value
Superfamily ARM repeat 0.00544
Family PBS lyase HEAT-like repeat 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9NZQ3
Sequence length 722
Comment (sp|Q9NZQ3|SPN90_HUMAN) Wiskott-Aldrich syndrome protein-interacting protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=NCKIPSD; OC=Catarrhini; Hominidae; Homo.
Sequence
MYRALYAFRSAEPNALAFAAGETFLVLERSSAHWWLAARARSGETGYVPPAYLRRLQGLE
QDVLQAIDRAIEAVHNTAMRDGGKYSLEQRGVLQKLIHHRKETLSRRGPSASSVAVMTSS
TSDHHLDAAAARQPNGVCRAGFERQHSLPSSEHLGADGGLYQIPLPSSQIPPQPRRAAPT
TPPPPVKRRDREALMASGSGGHNTMPSGGNSVSSGSSVSSTSLDTLYTSSSPSEPGSSCS
PTPPPVPRRGTHTTVSQVQPPPSKASAPEPPAEEEVATGTTSASDDLEALGTLSLGTTEE
KAAAEAAVPRTIGAELMELVRRNTGLSHELCRVAIGIIVGHIQASVPASSPVMEQVLLSL
VEGKDLSMALPSGQVCHDQQRLEVIFADLARRKDDAQQRSWALYEDEGVIRCYLEELLHI
LTDADPEVCKKMCKRNEFESVLALVAYYQMEHRASLRLLLLKCFGAMCSLDAAIISTLVS
SVLPVELARDMQTDTQDHQKLCYSALILAMVFSMGEAVPYAHYEHLGTPFAQFLLNIVED
GLPLDTTEQLPDLCVNLLLALNLHLPAADQNVIMAALSKHANVKIFSEKLLLLLNRGDDP
VRIFKHEPQPPHSVLKFLQDVFGSPATAAIFYHTDMMALIDITVRHIADLSPGDKLRMEY
LSLMHAIVRTTPYLQHRHRLPDLQAILRRILNEEETSPQCQMDRMIVREMCKEFLVLGEA
PS
Download sequence
Identical sequences Q9NZQ3
HR3534 ENSP00000294129 gi|7705266|ref|NP_057537.1| NP_057537.1.87134 NP_057537.1.92137 ENSP00000294129 9606.ENSP00000294129 ENSP00000294129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]