SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9NZR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9NZR1
Domain Number 1 Region: 184-346
Classification Level Classification E-value
Superfamily RNI-like 1.7e-45
Family 28-residue LRR 0.00000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9NZR1
Sequence length 351
Comment (sp|Q9NZR1|TMOD2_HUMAN) Neuronal tropomodulin KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=TMOD2; OC=Catarrhini; Hominidae; Homo.
Sequence
MALPFQKELEKYKNIDEDELLGKLSEEELKQLENVLDDLDPESAMLPAGFRQKDQTQKAA
TGPFDREHLLMYLEKEALEQKDREDFVPFTGEKKGRVFIPKEKPIETRKEEKVTLDPELE
EALASASDTELYDLAAVLGVHNLLNNPKFDEETANNKGGKGPVRNVVKGEKVKPVFEEPP
NPTNVEISLQQMKANDPSLQEVNLNNIKNIPIPTLREFAKALETNTHVKKFSLAATRSND
PVAIAFADMLKVNKTLTSLNIESNFITGTGILALVEALKENDTLTEIKIDNQRQQLGTAV
EMEIAQMLEENSRILKFGYQFTKQGPRTRVAAAITKNNDLVRKKRVEADRR
Download sequence
Identical sequences G3RI10 Q9NZR1
ENSP00000249700 9606.ENSP00000249700 gi|7657647|ref|NP_055363.1| ENSP00000249700 ENSP00000249700 NP_055363.1.87134 NP_055363.1.92137 XP_004056233.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]