SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9NZU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9NZU1
Domain Number 1 Region: 72-344
Classification Level Classification E-value
Superfamily L domain-like 1.62e-48
Family Ngr ectodomain-like 0.0036
Further Details:      
 
Domain Number 2 Region: 25-92
Classification Level Classification E-value
Superfamily L domain-like 0.00000051
Family Ngr ectodomain-like 0.0037
Further Details:      
 
Domain Number 3 Region: 413-482
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000106
Family Fibronectin type III 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9NZU1
Sequence length 646
Comment (sp|Q9NZU1|FLRT1_HUMAN) Fibronectin-like domain-containing leucine-rich transmembrane protein 1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FLRT1; OC=Catarrhini; Hominidae; Homo.
Sequence
MDLRDWLFLCYGLIAFLTEVIDSTTCPSVCRCDNGFIYCNDRGLTSIPADIPDDATTLYL
QNNQINNAGIPQDLKTKVNVQVIYLYENDLDEFPINLPRSLRELHLQDNNVRTIARDSLA
RIPLLEKLHLDDNSVSTVSIEEDAFADSKQLKLLFLSRNHLSSIPSGLPHTLEELRLDDN
RISTIPLHAFKGLNSLRRLVLDGNLLANQRIADDTFSRLQNLTELSLVRNSLAAPPLNLP
SAHLQKLYLQDNAISHIPYNTLAKMRELERLDLSNNNLTTLPRGLFDDLGNLAQLLLRNN
PWFCGCNLMWLRDWVKARAAVVNVRGLMCQGPEKVRGMAIKDITSEMDECFETGPQGGVA
NAAAKTTASNHASATTPQGSLFTLKAKRPGLRLPDSNIDYPMATGDGAKTLAIHVKALTA
DSIRITWKATLPASSFRLSWLRLGHSPAVGSITETLVQGDKTEYLLTALEPKSTYIICMV
TMETSNAYVADETPVCAKAETADSYGPTTTLNQEQNAGPMASLPLAGIIGGAVALVFLFL
VLGAICWYVHQAGELLTRERAYNRGSRKKDDYMESGTKKDNSILEIRGPGLQMLPINPYR
AKEEYVVHTIFPSNGSSLCKATHTIGYGTTRGYRDGGIPDIDYSYT
Download sequence
Identical sequences Q9NZU1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]