SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9P0S3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9P0S3
Sequence length 153
Comment (sp|Q9P0S3|ORML1_HUMAN) Adoplin-1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ORMDL1; OC=Catarrhini; Hominidae; Homo.
Sequence
MNVGVAHSEVNPNTRVMNSRGMWLTYALGVGLLHIVLLSIPFFSVPVAWTLTNIIHNLGM
YVFLHAVKGTPFETPDQGKARLLTHWEQLDYGVQFTSSRKFFTISPIILYFLASFYTKYD
PTHFILNTASLLSVLIPKMPQLHGVRIFGINKY
Download sequence
Identical sequences A0A096NBS9 A0A0D9RIQ9 A0A250YAG0 A0A2J8WVZ7 A0A2K5HBY3 A0A2K5MUL2 A0A2K5ZLX5 A0A2K6BRS1 A0A2K6LH95 A0A2K6QPM3 F7D5L1 G1R4D6 G3RGX6 G3T0L4 G7PL13 H2QJ51 Q5R8X5 Q9P0S3
gi|189458852|ref|NP_001121622.1| gi|7706009|ref|NP_057551.1| NP_001121622.1.87134 NP_001121622.1.92137 NP_001127461.1.23681 NP_001253278.1.72884 NP_001272293.1.63531 NP_057551.1.87134 NP_057551.1.92137 XP_001165682.1.37143 XP_001165741.1.37143 XP_003253895.1.23891 XP_003253896.1.23891 XP_003253897.1.23891 XP_003253898.1.23891 XP_003406217.1.64505 XP_003764092.1.9362 XP_004033001.1.27298 XP_004033003.1.27298 XP_004092039.1.23891 XP_004092040.1.23891 XP_004701547.1.18182 XP_005247027.1.92137 XP_005373371.1.28644 XP_007963822.1.81039 XP_007963823.1.81039 XP_007963825.1.81039 XP_008591615.1.73410 XP_008833852.1.79516 XP_008948839.1.60992 XP_008948840.1.60992 XP_008948843.1.60992 XP_009236172.1.23681 XP_009236173.1.23681 XP_009236174.1.23681 XP_009236176.1.23681 XP_009236177.1.23681 XP_009236178.1.23681 XP_009236179.1.23681 XP_010368570.1.97406 XP_010368571.1.97406 XP_010368572.1.97406 XP_010368573.1.97406 XP_010601043.1.64505 XP_011716615.1.29376 XP_011716616.1.29376 XP_011716617.1.29376 XP_011791847.1.43180 XP_011791849.1.43180 XP_011791850.1.43180 XP_011791851.1.43180 XP_011791852.1.43180 XP_011829631.1.47321 XP_011829632.1.47321 XP_011829633.1.47321 XP_011829635.1.47321 XP_011829636.1.47321 XP_011829637.1.47321 XP_011902660.1.92194 XP_011902661.1.92194 XP_011902662.1.92194 XP_012355828.1.23891 XP_014965984.1.72884 XP_014965985.1.72884 XP_014965986.1.72884 XP_015287577.1.63531 XP_015287578.1.63531 XP_015287579.1.63531 XP_015287580.1.63531 XP_016860836.1.92137 XP_017501122.1.32401 XP_017501129.1.32401 XP_017501134.1.32401 XP_017721107.1.44346 XP_017721113.1.44346 XP_017721117.1.44346 XP_017721123.1.44346 XP_018877568.1.27298 XP_018877569.1.27298 XP_018877570.1.27298 XP_018877571.1.27298 XP_020027992.1.5219 XP_020027993.1.5219 XP_020849196.1.61212 ENSPTRP00000021773 ENSP00000326869 ENSNLEP00000008058 ENSMMUP00000018799 9544.ENSMMUP00000018800 9598.ENSPTRP00000021773 9600.ENSPPYP00000014542 9606.ENSP00000326869 ENSGGOP00000014888 ENSPANP00000010234 ENSGGOP00000014888 ENSNLEP00000008058 ENSMMUP00000018799 ENSMMUP00000018800 ENSP00000326869 ENSP00000376160 ENSP00000376161 ENSPTRP00000021773 ENSP00000326869 ENSP00000376160 ENSP00000376161 ENSPPYP00000023865 ENSLAFP00000006520 ENSLAFP00000006520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]