SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9UBD0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9UBD0
Domain Number 1 Region: 97-211
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.66e-21
Family Heat-shock transcription factor 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9UBD0
Sequence length 423
Comment (sp|Q9UBD0|HSFX1_HUMAN) Heat shock transcription factor, X-linked KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=HSFX2; OC=Catarrhini; Hominidae; Homo.
Sequence
MEDKRSLSMARCEERNSRGQDHGLERVPFPPQLQSETYLHPADPSPAWDDPGSTGSPNLR
LLTEEIAFQPLAEEASFRRPHPDGDVPPQGEDNLLSLPFPQKLWRLVSSNQFSSIWWDDS
GACRVINQKLFEKEILKRDVAHKVFATTSIKSFFRQLNLYGFRKRRQCTFRTFTRIFSAK
RLVSILNKLEFYCHPYFQRDSPHLLVRMKRRVGVKSAPRHQEEDKPEAAGSCLAPADTEQ
QDHTSPNENDQVTPQHREPAGPNTQIRSGSAPPATPVMVPDSAVASDNSPVTQPAGEWSE
GSQAHVTPVAAVPGPAALPFLYVPGSPTQMNSYGPVVALPTASRSTLAMDTTGLPAPGML
PFCHLWVPVTLVAAGAAQPAASMVMFPHLPALHHHCPHSHRTSQYMPASDGPQAYPDYAD
QST
Download sequence
Identical sequences A0A140VK21 Q9UBD0
ENSP00000359444 ENSP00000427855 NP_001157887.1.87134 NP_001157887.1.92137 NP_057237.1.87134 NP_057237.1.92137 9606.ENSP00000306472 9606.ENSP00000359444 gi|256542315|ref|NP_001157887.1| gi|7706603|ref|NP_057237.1| ENSP00000359444 ENSP00000431063 ENSP00000469223 ENSP00000470173 ENSP00000359444 ENSP00000469223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]