SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9UBD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9UBD3
Domain Number 1 Region: 26-111
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 1.26e-23
Family Interleukin 8-like chemokines 0.00000467
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9UBD3
Sequence length 114
Comment (sp|Q9UBD3|XCL2_HUMAN) XC chemokine ligand 2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=XCL2; OC=Catarrhini; Hominidae; Homo.
Sequence
MRLLILALLGICSLTAYIVEGVGSEVSHRRTCVSLTTQRLPVSRIKTYTITEGSLRAVIF
ITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
Download sequence
Identical sequences Q9UBD3
ENSP00000356793 NP_003166.1.87134 NP_003166.1.92137 9606.ENSP00000356793 ENSP00000356793 gi|4506855|ref|NP_003166.1| ENSP00000356793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]