SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9UBP8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9UBP8
Sequence length 84
Comment (sp|Q9UBP8|KAAG1_HUMAN) RU2 antisense gene protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=KAAG1; OC=Catarrhini; Hominidae; Homo.
Sequence
MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRP
HRTQGAGSPPETNEKLTNPQVKEK
Download sequence
Identical sequences A0A2I3GBI8 A0A2I3RC57 Q9UBP8
9598.ENSPTRP00000030347 9606.ENSP00000274766 ENSNLEP00000022565 ENSP00000274766 ENSPTRP00000030347 ENSP00000274766 ENSP00000274766 ENSNLEP00000022565 gi|31044434|ref|NP_851854.1| NP_851854.1.87134 NP_851854.1.92137 ENSPTRP00000030347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]