SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9UC07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9UC07
Domain Number 1 Region: 369-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.99e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 256-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.66e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 3 Region: 22-78
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.62e-21
Family KRAB domain (Kruppel-associated box) 0.0003
Further Details:      
 
Domain Number 4 Region: 410-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.07e-21
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 5 Region: 200-257
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-19
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 6 Region: 514-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.9e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 312-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-18
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 8 Region: 466-515
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-17
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 9 Region: 162-214
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000767
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9UC07
Sequence length 566
Comment (sp|Q9UC07|ZNF69_HUMAN) hZNF3 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ZNF69; OC=Catarrhini; Hominidae; Homo.
Sequence
MPCCSHRRCREDPGTSESQEMDPVAFDDVAVNFTQEEWALLDISQRKLYKEVMLETFRNL
TSVGKSWKDQNIEYEYQNPRRNFRSLIEKKVNEIKDDSHCGETFTQVPDDRLNFQEKKAS
PEIKSCDSFVCGEVGLGNSSFNMNIRGDIGHKAYEYQEYGPKPCKCQQPKKAFRYHPSFR
TPQRDHTGEKPYACKECGKTFISHSSIQRHVVMHSGDGPYKCKFCGKAFHCLSLYLIHER
IHTGEKPYECKQCGKSFSYSATLRIHERTHTGEKPYECQQCGKAFHSPRCYRRHERIHTG
EKAYQCKECGKAFTCPQYVRIHERTHSRKKPYECTQCGKALSSLTSFQTHIRMHSGERPY
ECKICGKGFCSANSFQRHEKTHSGEKPYKCKQCGKAFIHSSSLRYHERIHTGEKPYECKQ
CGKAFRSSSHLQLHGRTHTGEKPYECQECGKAFRSMKNLQSHERTQTHVRIHSGERPYKC
KLCGKGFYCPKSLQRHEKTHTGEKLYECKQCGEAFSSSSSFRYHERTHTGEKPYKCKQCG
KAFRAASVLRMHGRTHPEDKPYECKQ
Download sequence
Identical sequences Q9UC07
ENSP00000402985 ENSP00000402985 ENSP00000345333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]